SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384217414|ref|YP_005608580.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384217414|ref|YP_005608580.1|
Domain Number 1 Region: 2-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.18e-108
Family GABA-aminotransferase-like 0.00000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384217414|ref|YP_005608580.1|
Sequence length 393
Comment hypothetical protein BJ6T_37180 [Bradyrhizobium japonicum USDA 6]
Sequence
MIPYGRQDISAEDIDAVRDVLTSDWLTQGQAGPRFEQGLAKYCGAAHGIAVSNATAALHI
ACLALDLGPGDILWTVPNTFVASANCALYCGATVDFVDIDPRTYNMSVAALAEKLAQAEA
AGRLPKVVVPVHFAGQSCEMVEIRALADRYRFHIVEDASHAVGGEYRGRKVGDGALSDVT
VFSFHPVKIITTGEGGMLMTNAPKLAERLSYLRSHGIIRPMQSPPTADERRSNEDQHGPW
MYEQIELGLNYRMTDIQAALGSSQLVRLDAFVERRRELAARYDRLLAKLPVTRPWQHPDT
NSAWHLYVIRLRRNEIKLSRRQVFEALRAAGIGVNVHYIPVHTQPYYQRLGFKVGMFPEA
ESYYQDAITLPLFSKMTDAEQDTVVAALRKILA
Download sequence
Identical sequences G7DNB2
gi|384217414|ref|YP_005608580.1| WP_014493846.1.18950 WP_014493846.1.35620 WP_014493846.1.77977 WP_014493846.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]