SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384217485|ref|YP_005608651.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384217485|ref|YP_005608651.1|
Domain Number 1 Region: 22-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-103
Family GABA-aminotransferase-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384217485|ref|YP_005608651.1|
Sequence length 383
Comment hypothetical protein BJ6T_37890 [Bradyrhizobium japonicum USDA 6]
Sequence
MNQHLRSEPIPFIDVASQRRRLGASLDAAVKRVMDHCQFVNGPEVFELEKQLAAYCGAKH
VIGCSNGTDALLMVLMAKNVGPGDAVLCPSFTFIATASPAARTGATPVYVDVDEATFNMS
PESLKRGIAAARKAGLKPVAVIPVDLFGQPADHDAIAEIAKAEGMFIIDDAAQGFGASYK
GRKLGTFGLATTTSFFPAKPLGCFGDGGAILTDDDELAATLRSIRVHGQGVDKYDNVRLG
LTGRLDTMQAAILIEKLKIFDDEIAARNKVAERYARGLSNVVTVPRLAPGNTSVWAQYTI
RLPEGTDRDGFAAALKAQGVPTAIYYGKSMHQQTAYKQYPVADGGLPGCESLSQDVISLP
MHAYLTEADQERIIAAVRGAIAG
Download sequence
Identical sequences A0A0A3Z2C2 G7DPU7
WP_014493917.1.18950 WP_014493917.1.35620 WP_014493917.1.67973 WP_014493917.1.6944 WP_014493917.1.77977 WP_014493917.1.97209 gi|384217485|ref|YP_005608651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]