SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384218365|ref|YP_005609531.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384218365|ref|YP_005609531.1|
Domain Number 1 Region: 8-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.26e-176
Family GABA-aminotransferase-like 0.000000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384218365|ref|YP_005609531.1|
Sequence length 432
Comment glycine hydroxymethyltransferase [Bradyrhizobium japonicum USDA 6]
Sequence
MTSARTASAPDSFFTASLDQADPEIAAAIKGELGRQRHEVELIASENIVSRAVLEAQGSV
MTNKYAEGYPGARYYGGCEWVDVAENLAIDRAKKLFGANFANVQPNSGSQMNQAVFLALL
QPGDTFMGLDLAAGGHLTHGSPVNMSGKWFKAAHYTVRREDQIIDMDAVAKQAEEVKPKL
IVAGGSAYSRAWDFKRFREIADSVGAYLLVDMAHFAGLVAGGVHASPVPYAHVTTTTTHK
SLRGPRGGLILSNDEVLAKKLNSAIFPGLQGGPLMHVIAAKAVAFGEALRPDFKIYAKNV
VENAKALAEAMKSHGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAAITCNKNGIPF
DPEKPFVTSGLRLGTPAATTRGFGVAEFQQVGGMIAEVLNAIAQSDDGKAPLVEAAIKER
VKALTDRFPIYQ
Download sequence
Identical sequences A0A023XDC0 A0A0A3XKN5 G7D6Q7
WP_014494772.1.35620 WP_014494772.1.56529 WP_014494772.1.67973 WP_014494772.1.6944 WP_014494772.1.77977 WP_014494772.1.85912 WP_014494772.1.97209 gi|384218365|ref|YP_005609531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]