SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384218408|ref|YP_005609574.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384218408|ref|YP_005609574.1|
Domain Number 1 Region: 7-424
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.5e-123
Family Cystathionine synthase-like 0.00000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384218408|ref|YP_005609574.1|
Sequence length 426
Comment O-acetylhomoserine sulfhydrylase [Bradyrhizobium japonicum USDA 6]
Sequence
MSDRLPGFSTLAVHAGAQPDPTTGARATPIYQTTSFVFNDADHAASLFGLQAFGNIYTRI
GNPTNAVLEERVAALEGGTAALAVASGHAAQVVVLQQLLQPGDEFIAARKLYGGSINQFT
HAFKSFGWNVVWADSDDIASFERAVTPRTKAIFIESIANPGGSITDIEAISTVARKAGVP
LIVDNTLASPYLIRPIDHGADIVVHSLTKFLGGHGNSLGGIIVDAGTFDWSTGGKYPMLS
EPRPEYHGIRLQETFGNFAFAIACRVLGLRDLGPALSPFNAFMILTGIETLPLRMQKHCD
NAKAVAEFLVGHPAVASVSYAGLASDKYNQLARKYAPKGAGAVFTFSLKGGYDAGVSLVS
KLQLFSHLANVGDTRSLVIHPASTTHSQLDDAAKVKSGAGPDVVRLSIGIEDKEDLIADL
EQALGA
Download sequence
Identical sequences G7D7S2
gi|384218408|ref|YP_005609574.1| WP_014494813.1.18950 WP_014494813.1.35620 WP_014494813.1.77977 WP_014494813.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]