SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384219319|ref|YP_005610485.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384219319|ref|YP_005610485.1|
Domain Number 1 Region: 4-383
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.18e-79
Family Cystathionine synthase-like 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384219319|ref|YP_005610485.1|
Sequence length 400
Comment hypothetical protein BJ6T_56420 [Bradyrhizobium japonicum USDA 6]
Sequence
MTKLRVYDDTRALFHLPDGVIYLDGNSLGALPLGVAERVGNVITTEWGNELIRAWNSAGW
YAQPRHVGDRIARLVGAEAGSVMVGDTLSLKVYQALAAALNMNASRKVVLSDTGNFPTDL
YMAEGLIATLGRGHQLRLVAPEEIEAALSEEIAVLYITEVDYRTGRRHDMATLTARAHAL
GIVTVWDLAHSAGALPVDLAGCGADFAAGCTYKYINAGPGAPAFLYVAPRHADGARAALS
GWMGHAKPFAFELGYAAAGGVERMRVGTPPVLAMAALEASLDIWDRVDIREVRARSLALG
DLLIAEVERRCPELKLVTPRAHERRGSQVSFAFEGGYAAMQALIARGLIGDFRAPDIMRF
GITPLYIGESEIMRAAEIIEEVIAGEVWRRPEYQVVNAVT
Download sequence
Identical sequences G7DGC3
gi|384219319|ref|YP_005610485.1| WP_014495716.1.18950 WP_014495716.1.35620 WP_014495716.1.77977 WP_014495716.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]