SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384219866|ref|YP_005611032.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384219866|ref|YP_005611032.1|
Domain Number 1 Region: 94-163
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.22e-29
Family CO dehydrogenase ISP C-domain like 0.00017
Further Details:      
 
Domain Number 2 Region: 11-87
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384219866|ref|YP_005611032.1|
Sequence length 172
Comment oxidoreductase with iron-sulfur subunit [Bradyrhizobium japonicum USDA 6]
Sequence
MTRLEADRRHAVRFSLNGKPVEGEAEPRTLLSDFLRHQLGATGTHVGCEHGVCGACTIVV
DGMLTRSCLTLAAQVDGCELRTVEGLAPSADRLGVLQQAFRRNHALQCGFCTAGILMSLD
HYLAKNPAPTEAEIRDLLSGHICRCTGYTPIIQAALEAAAELASSKKETSDA
Download sequence
Identical sequences G7DNF4
gi|384219866|ref|YP_005611032.1| WP_014496254.1.18950 WP_014496254.1.35620 WP_014496254.1.77977 WP_014496254.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]