SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384220041|ref|YP_005611207.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384220041|ref|YP_005611207.1|
Domain Number 1 Region: 87-153
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.44e-32
Family CO dehydrogenase ISP C-domain like 0.00016
Further Details:      
 
Domain Number 2 Region: 6-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.91e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384220041|ref|YP_005611207.1|
Sequence length 158
Comment oxidoreductase protein [Bradyrhizobium japonicum USDA 6]
Sequence
MAKTALQFRHNGRDVAIFVDGGTNLLVALRELIGDMTPKFGCGQGGCGTCSVLIDGELHL
SCLTLAETVAGRSVETLDGLRQGPKLHPLQRAFADHFAAQCGYCTPGMLMAAKALLDRNP
QPSRAEVVEAISGNICRCTGYEPIIDAILAASGGRASA
Download sequence
Identical sequences G7DQ98
WP_014496429.1.18950 WP_014496429.1.35620 WP_014496429.1.56529 WP_014496429.1.77977 WP_014496429.1.97209 gi|384220041|ref|YP_005611207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]