SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384220711|ref|YP_005611877.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384220711|ref|YP_005611877.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.1e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0018
Further Details:      
 
Domain Number 2 Region: 83-148
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.49e-26
Family CO dehydrogenase ISP C-domain like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384220711|ref|YP_005611877.1|
Sequence length 149
Comment oxidoreductase with iron-sulfur subunit [Bradyrhizobium japonicum USDA 6]
Sequence
MANLTINGKTFTLDVEPDTPLLWAIRENAGLTGTKYGCGIAQCGACTVHMDGVATRSCGI
SVSEAEGKKITTIEGLASGDTLHKVQAAWIAKDVPQCGYCQSGMIMAVAALLAEKPKPTD
ADIDEAITNICRCGTFQQVREAIHTIASA
Download sequence
Identical sequences A0A023XJ34 G7D5L8
gi|384220711|ref|YP_005611877.1| WP_014497095.1.18950 WP_014497095.1.35620 WP_014497095.1.52884 WP_014497095.1.56529 WP_014497095.1.62155 WP_014497095.1.64673 WP_014497095.1.67582 WP_014497095.1.6944 WP_014497095.1.77977 WP_014497095.1.91491 WP_014497095.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]