SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384220861|ref|YP_005612027.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384220861|ref|YP_005612027.1|
Domain Number 1 Region: 23-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.85e-85
Family AAT-like 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384220861|ref|YP_005612027.1|
Sequence length 410
Comment aminotransferase [Bradyrhizobium japonicum USDA 6]
Sequence
MTSSFDFAPLFPAGLPAPSARWTGLAKYSFVGGNNDSEQLPLDGLIEATNSALQKEGRSL
ATYGLAHGPQGYLPLREFLVTKLKRDAGINCTVDDLLIVSGSLQALDLVNATLLTRGDTV
IFEQDSYQGSLTRLARLGVNVVGIPLDKDGMRMDVLASTLADLKGRGIRPKYIYTIPTVQ
NPTGSIMPESRRAELVRLAAEYGVPIFEDDCYADLVWSGQRPPAIHAMSPNGGVIHIGSF
SKSIAPALRVGFIVAPWDVMSRMLALKTDAGSGALEQMVLAAYCKPHFSTHVPALTKALR
TKLDTLMEALNEQFGTAAEFEEPKGGIFLWVKLPDQVDTLKLYQAALAAGVSINPGPEWS
TNKPHSSSRLRLCFASPSHQQIREGVAVLAEVCRKEFGVPARSANVQKRA
Download sequence
Identical sequences G7D6Z0
gi|384220861|ref|YP_005612027.1| WP_014497239.1.18950 WP_014497239.1.35620 WP_014497239.1.77977 WP_014497239.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]