SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384221381|ref|YP_005612547.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384221381|ref|YP_005612547.1|
Domain Number 1 Region: 55-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.65e-73
Family AAT-like 0.0000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384221381|ref|YP_005612547.1|
Sequence length 377
Comment aminotransferase [Bradyrhizobium japonicum USDA 6]
Sequence
MNSRISKRSAIAQGFAPFNSSSAKHGINFGYALADPVMFAELPWPVAFDGGTGVALADLP
QYTDAAGLPELRTKLALRYGVRHDQVMLTGGASQALQLLADGWIDPGDVVLMEDPSYLGA
LRTFSIAGATVVQLGLAAEGVDLNEVEAILQTNARVKLFYTMPAFHNPTGRQMSRDYVAK
LAALLARSGALLVQDLVYAELPYNGPAHWVAPGNNVINVHSISKVAGPGLRLGWVLAESD
IINRLAHLKRDGGVSPVLSNIVLGLLQSSALDSHITRLREHYRAKRDSVHSLLQRSRICD
LGYSVPSGGFSFWVRLTPGTDPERFIEAASRLHGVHLVNGRNYGPGSGRHMRLCFSYLPI
SLIEQGLERLSHLHANL
Download sequence
Identical sequences A0A0A3XLJ1 G7DB76 Q89TA3
gi|384221381|ref|YP_005612547.1| NP_768776.1.11505 WP_011084930.1.15658 WP_011084930.1.18950 WP_011084930.1.24896 WP_011084930.1.35620 WP_011084930.1.43076 WP_011084930.1.62673 WP_011084930.1.64673 WP_011084930.1.67778 WP_011084930.1.67973 WP_011084930.1.6944 WP_011084930.1.77977 WP_011084930.1.81322 WP_011084930.1.85912 WP_011084930.1.8978 WP_011084930.1.90507 WP_011084930.1.97209 gi|27377247|ref|NP_768776.1| 224911.blr2136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]