SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384221581|ref|YP_005612747.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384221581|ref|YP_005612747.1|
Domain Number 1 Region: 6-455
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-113
Family GABA-aminotransferase-like 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384221581|ref|YP_005612747.1|
Sequence length 466
Comment hypothetical protein BJ6T_79130 [Bradyrhizobium japonicum USDA 6]
Sequence
MSDLKAIAELDRSSVLHPFTQLKEFASGQAGDPTIVTGGKGIRIEDAQGHTYIDAFAGLY
CVNIGYGRTEVAEAIARQAYKLAYYHTYAAHTTDELAKLANRLVRMAPGKPSKVFFGLSG
SDANETQAKLVWYYNNLRGHPKKKKIISRERGYHGCSVISGSMTGMSFYHDHMDLPFPGI
LHTGTPHHYWGAEPGETEEDFSRRRAAELEQLIVREGPETIGAFIGEPVLGTGGITPPPA
GYWREVQAVLRRYDILLIADEVICGFGRTGADFGSTLYGMEPDLVTVAKGLTSGYVPLSG
AIVGERVYAVMEEAADRIGAFSHGYTYSGHPIAAAAANAVLDIVENERLSDRARVVGAHF
QKRLKERFAQLEIVGEVRGVGLLGAIEFVADRQSKRRFDAQLKVGARISKAARDRGLIAR
AMPHGDILGFAPPLVVSEAEIDEIVELAYRATKQVMDELAKDAAMA
Download sequence
Identical sequences G7DD51
WP_014497875.1.18950 WP_014497875.1.35620 WP_014497875.1.77977 WP_014497875.1.97209 gi|384221581|ref|YP_005612747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]