SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384221732|ref|YP_005612898.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384221732|ref|YP_005612898.1|
Domain Number 1 Region: 7-378
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.52e-97
Family Cystathionine synthase-like 0.000000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384221732|ref|YP_005612898.1|
Sequence length 393
Comment nitrogenase metalloclusters biosynthesis protein [Bradyrhizobium japonicum USDA 6]
Sequence
MSENRAPIYLDNNATTRTDPSVVQTMLPFFTEQFGNASSAHAFGNEAAIAVRQARRSLSG
LLGSAYDHEIVFTSGGTEANNAAILSALATQEGRDEVVTTSVEHSAVLALTEQLAARGVK
TRIIAVDACGRLDIEAFRCALGPRTAIASVMWANNETGTIFPVKCLAGWTREAGALFHTD
AVQAIGKVRLNLKDSTIDMLSLSAHKLHGPKGVGALYLRKGTKFQPLICGGSQERGRRAG
TENIPGIVGLGKAAELAAERLEPERIRIGALRDRLEQGILRNGECVVLGDIRNRLANTTN
IAFDHLEGEAIAHRLNRAGIAVSLGSACRSGSMQPSHVLRAMQVPAWRMHGAVRFSLSRE
TSLAEVDEAVCAVSDIVTRMRASSRATVREQTS
Download sequence
Identical sequences A0A023XXW0 A0A0A3XIU7 A0A270RPU8 A0A2A6MN74 G7DEY4 P37030
224911.blr1756 gi|384221732|ref|YP_005612898.1| gi|27376867|ref|NP_768396.1| NP_768396.1.11505 WP_011084565.1.15658 WP_011084565.1.18950 WP_011084565.1.25528 WP_011084565.1.2739 WP_011084565.1.35620 WP_011084565.1.43076 WP_011084565.1.52884 WP_011084565.1.53516 WP_011084565.1.53518 WP_011084565.1.56529 WP_011084565.1.62155 WP_011084565.1.64673 WP_011084565.1.67582 WP_011084565.1.67972 WP_011084565.1.67973 WP_011084565.1.6944 WP_011084565.1.77977 WP_011084565.1.81322 WP_011084565.1.88374 WP_011084565.1.8978 WP_011084565.1.90507 WP_011084565.1.91491 WP_011084565.1.97209 WP_011084565.1.9909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]