SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193620273|ref|XP_001943812.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193620273|ref|XP_001943812.1|
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.14e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00033
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.83e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193620273|ref|XP_001943812.1|
Sequence length 112
Comment PREDICTED: similar to transcription initiation factor IIA gamma chain [Acyrthosiphon pisum]
Sequence
MSYQLYRNTTLGNTLQESIDEMIQYGQITPALGMKILLQFDKSVNNSLATRVKSKITFKA
GKMDTYRFCDNVWTFMLSDVEFKETQEMAKVEKLKIVACDGKSVTDENSKKN
Download sequence
Identical sequences A0A2H8TGQ2 C4WSL4
gi|193620273|ref|XP_001943812.1| NP_001155689.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]