SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193624660|ref|XP_001952666.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193624660|ref|XP_001952666.1|
Domain Number 1 Region: 271-371
Classification Level Classification E-value
Superfamily TAFH domain-like 2.88e-32
Family TAFH domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 606-653
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000879
Family TBP-associated factors, TAFs 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193624660|ref|XP_001952666.1|
Sequence length 814
Comment PREDICTED: similar to transcription initiation factor [Acyrthosiphon pisum]
Sequence
MPGISQVDFVGQQQQQQQQQQQQQQQHHHHVVNPTLAHNYAAPQPMKSLDQVKVVYSNSA
NSRNYVPVNSLPNGTINSTSTGSGTAVVIKSTSQQHHHNSPPVSTMTLPGQVSSNQSSVS
SNVITVSKQMAQGVVTGNSPQTILPANVQILNVNALRPQNSQGGVNKNMSRVMIPQVVGS
RPGAPGLTLQTLQQAQGGHILLKTENGQYQLLRVGPAPSQGNTITQNNANFRVQSVPSVA
TNNVSIAGTPTTTPTQTIAQPQQAHQKIQQDNTKEKCRKFLANLLELSSKEPKPVERSVR
TLIQELVDAKVEPEQFCDRLEKLLNASPQPCLIGFLKKSLPLLRQSLMLKEMVIDGIRPP
QLSAQPTVVLANQQQATNTQVMGNILSNAASNQQTVRIMTSQPALTPARTINSQQQHRIV
SQQVRVQTPQGLTAVNKMGSIRIQPPVATSQTTTLPPPLTSTSSPRPPVGGGRQMLVKAV
PLKTTPVGSHIKISTPLASTPLPTNSITMPQPRIPPSPNIIAQPTTINKISTPITVAPPI
VALSKPPSKEKEKKSFSSSAAYVGDDDINDVAAMGGVNLAEETQRILGSTEFVGTQIRSC
KDEILLPQNPLVAKIKQIVNREGLEDAAADVPALVSHAVAERLKDLLEKFAVVAEHRLDF
NKADKRYEITRNIRGQIKCLEEIDKVERKKQDEMERELLLRAAKSRSKNEDPEQAKLKAK
AKEMQRVEMEELRQREANLTALNAIGPRKKPKLEPGISPSLQNQNSSISTSLTNRQTIPR
QRIKRVTMRDTLFVLEQEKDIRRKANFMFKPFLK
Download sequence
Identical sequences gi|193624660|ref|XP_001952666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]