SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193652527|ref|XP_001942978.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193652527|ref|XP_001942978.1|
Domain Number 1 Region: 160-301
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Third domain of FERM 0.000000702
Further Details:      
 
Domain Number 2 Region: 56-159
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-32
Family Second domain of FERM 0.00000904
Further Details:      
 
Domain Number 3 Region: 444-531
Classification Level Classification E-value
Superfamily Moesin tail domain 5.23e-29
Family Moesin tail domain 0.0000912
Further Details:      
 
Domain Number 4 Region: 4-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-18
Family First domain of FERM 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193652527|ref|XP_001942978.1|
Sequence length 531
Comment PREDICTED: similar to moesin/ezrin/radixin [Acyrthosiphon pisum]
Sequence
MVSGKTMNVRVTTMDAELEFAIQQTTTGKQLFDQVVKTIGLREVWFFGLQYTDNKGDMTW
IKLYKKVKNAILSDEIYCPSETSVLLASYAVQARHGDFNKLTHTPGFLTNDRLLPQRVMD
QHKMTREEWESSITTWWHEHRGMMREDAMMEYLKIAQDLEMYGVNYFDILNKKGTELFLG
VDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKR
ILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKLAKQQQREKLQLEIAAREKAEKKHQE
YEERLKVMQAEISKREQDLLSAQDMIRRLEEQLNKLQLAKEELEQRQNELQKMMERLEES
KNMEAVERAKLEEEIKAKQEEVMRIQSEVETKDEETKRLQEEVEEARRKQEEAAAAALAA
AATPKHHHVTENENEDNDEMVNGHETQDLDTDMDIVDPVEERRTLAERNERLQDQLKMLK
QDLAQSRDDTKETAMDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Download sequence
Identical sequences gi|193652527|ref|XP_001942978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]