SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193673952|ref|XP_001949236.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193673952|ref|XP_001949236.1|
Domain Number 1 Region: 208-348
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-43
Family Third domain of FERM 0.00000266
Further Details:      
 
Domain Number 2 Region: 98-207
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-35
Family Second domain of FERM 0.00000388
Further Details:      
 
Domain Number 3 Region: 535-615
Classification Level Classification E-value
Superfamily Moesin tail domain 4.84e-27
Family Moesin tail domain 0.00076
Further Details:      
 
Domain Number 4 Region: 12-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-25
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193673952|ref|XP_001949236.1|
Sequence length 615
Comment PREDICTED: similar to AGAP010346-PA [Acyrthosiphon pisum]
Sequence
MPPFKRKKTTGKSFPVKVCTLDAELEFNLELKATGRDLFDLVCRTIGLRETWYFGLQYED
SKGFIAWLKLDKKVQDQGIPQQTTMPFMFLAKFYPEEVAEELVQEVTQHLFFLQVNRAIL
AMDIYCPPEASVLLASYAVQAKYGDYDEGTYKPGMLASEELLPQRVIDQYQMTAEMWEER
IKVWYADHRGMSRDEAEIEYLKIAQDLDMYGVNYFPISNKKDTDLWLGVTSLGLNIYEKE
NKLTPKTTFQWSEIRHVSFDDKKFTIKPVDKTSPNFVFFSHKVRMNKLILDLCIGNHDLF
MRRRKPDSMEVQQMKTQAKEEKSRRQIERNKLAREKQLREIAEKEKSIMEQRLLQYQEEI
RLANEALRRSEETADLLAEKSRVAEEEAMLLGQKATEAEHKITQFRLTALKTEEEKVSLE
RKTREAEQLTARLVDESERRAAEANTLKEELLRARVAEKQAKEKLLEFLSRNAYVNTSVS
SLYSVSSSSALDLPADLHALRLNANSPQLSLTHSNPPALVDHNLPAYDFIAGNDMEELTL
EIEKERIQYLEKSKHLQDQLRDLKTEIEVLKVDEKQCELDMLHDEQVRLGENKYSTLKKV
KCGSTKARVAYFEEL
Download sequence
Identical sequences gi|193673952|ref|XP_001949236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]