SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71736782|ref|YP_275359.1| from Pseudomonas syringae pv. phaseolicola 1448A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71736782|ref|YP_275359.1|
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.12e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71736782|ref|YP_275359.1|
Sequence length 179
Comment cytochrome b561 [Pseudomonas syringae pv. phaseolicola 1448A]
Sequence
MDAPTSQRYTARARWLHWVMAILIVLAYTLILSRSQFGKGSEYRTLVVQSHFWVGIVILA
MAFFRVAERRRHRPPGITPPLEGALRLAATLTHYALYAFLFAQPLLGLLTVMVEKGALPI
PLTDLQIPWPLPTSDRRAETFEDVHKLLGSIFYYVIALHVVAALWHHLVRKDNTLKRML
Download sequence
Identical sequences A0A0N0ETK7 A0A0N0FFC4 A0A0N0FS22 A0A0N0G4P2 A0A0N1J7R9 A0A0N8R2Y6 A0A0P9K2K8 A0A0P9LC57 A0A0P9MEH1 A0A0P9N7H8 A0A0P9RAP8 A0A0P9RKJ8 A0A0P9RM90 A0A0P9SH48 A0A0P9U5J4 A0A0P9UQE4 A0A0P9UTE0 A0A0P9WWQ6 A0A0P9Y7Y2 A0A0Q0AS59 A0A0Q0ET00 A0A0W0IE55 A0A108WK89 A0A1E3XN63 A0A2G4CZX4 A0A2K4WT24 E7PR17 F3K2A5 Q48GX4
264730.PSPPH_3199 WP_004656874.1.101587 WP_004656874.1.10739 WP_004656874.1.12791 WP_004656874.1.12808 WP_004656874.1.12881 WP_004656874.1.14024 WP_004656874.1.14608 WP_004656874.1.17116 WP_004656874.1.18327 WP_004656874.1.19745 WP_004656874.1.20304 WP_004656874.1.20715 WP_004656874.1.25100 WP_004656874.1.25848 WP_004656874.1.26784 WP_004656874.1.27185 WP_004656874.1.28195 WP_004656874.1.3022 WP_004656874.1.31015 WP_004656874.1.35401 WP_004656874.1.35444 WP_004656874.1.37820 WP_004656874.1.38140 WP_004656874.1.41549 WP_004656874.1.44448 WP_004656874.1.49487 WP_004656874.1.51882 WP_004656874.1.53091 WP_004656874.1.5324 WP_004656874.1.53919 WP_004656874.1.54272 WP_004656874.1.56773 WP_004656874.1.61736 WP_004656874.1.64420 WP_004656874.1.64801 WP_004656874.1.65008 WP_004656874.1.65103 WP_004656874.1.67845 WP_004656874.1.68125 WP_004656874.1.70455 WP_004656874.1.70637 WP_004656874.1.71486 WP_004656874.1.71999 WP_004656874.1.72524 WP_004656874.1.73894 WP_004656874.1.74374 WP_004656874.1.74479 WP_004656874.1.74923 WP_004656874.1.77449 WP_004656874.1.7830 WP_004656874.1.78571 WP_004656874.1.81106 WP_004656874.1.81421 WP_004656874.1.82498 WP_004656874.1.83605 WP_004656874.1.83709 WP_004656874.1.84762 WP_004656874.1.86037 WP_004656874.1.86868 WP_004656874.1.87004 WP_004656874.1.87025 WP_004656874.1.87869 WP_004656874.1.88936 WP_004656874.1.89047 WP_004656874.1.89853 WP_004656874.1.91552 WP_004656874.1.92572 WP_004656874.1.93917 WP_004656874.1.9487 gi|71736782|ref|YP_275359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]