SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|28477|fgenesh1_pg.5_#_606 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|28477|fgenesh1_pg.5_#_606
Domain Number 1 Region: 119-366
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-70
Family Glutamine synthetase catalytic domain 0.0027
Further Details:      
 
Domain Number 2 Region: 30-116
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 4.19e-19
Family Glutamine synthetase, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|28477|fgenesh1_pg.5_#_606
Sequence length 367
Sequence
MVRVISSSLASESATVISNTGNLMKYMNLDQRGRIQAEYVWIDANGGTRSKTKTLFKPVT
SVDELPEWNFDGSSTSQAPGDNSDVYLRPVAYYPDPFRQGDNILVLCETWDADGSPNKYN
YRHEANRLMETNAHEGFWFGLEQEYTLLGTDGWPYGWPRGGFPGAQGPYYCGVGTGKVYC
RDIVEAHYRACLYAGINISGINAEVMPSQWEYQVGPCPGIDMGDHLWMSRFLLHRVAEEF
GVRISFEPKPIKGEWNGAGLHSNVSTNATRAEGGMKAIEAAMKKFEARHVEHIAVYGEGN
EERLTGRHETGNIDKFSYGVADRGGSIRIPRQVAKDNKGYFEDRRPASNADPYQITGIIV
ETMCGGL
Download sequence
Identical sequences jgi|Pench1|28477|fgenesh1_pg.5_#_606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]