SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|39303|fgenesh1_pm.11_#_15 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|39303|fgenesh1_pm.11_#_15
Domain Number 1 Region: 8-332
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.33e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.00000042
Further Details:      
 
Domain Number 2 Region: 443-537
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.02e-39
Family D-aminopeptidase, middle and C-terminal domains 0.0000949
Further Details:      
 
Weak hits

Sequence:  jgi|Pench1|39303|fgenesh1_pm.11_#_15
Domain Number - Region: 355-431
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00115
Family D-aminopeptidase, middle and C-terminal domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|39303|fgenesh1_pm.11_#_15
Sequence length 538
Sequence
MEITKEKVQEVLNKTALRCRGPGGAIAVVKDGEIIGQRVWGFADLDQRIPMTAQTQMPIC
SITKQFVCALLIDLERNPTPTLAAKGDVRKQLSDHLTEILSPELTSDGELTIDRLCDMQS
GMRDYWAMTTLWGSKPDDEFLIERDCGPLLARTKSFQFQPGTEYSYCNVNFHILARVIER
ATEESLDKLLEERILRPAGMSTAFLCPNTAHHPSPCVGYEGDEQHGFTAATNRMEWSGDA
GLVASLTDMIAYEKYLDRCYADPQSWYHAAIAAPKFKDGTPATYRYGLSHTDIDGVDTIG
HGGALRGYRLHRRHAPRQRLSVVIMLNSDSGTFGPNIDIFKDLLGLPKPVSASIQAAESW
VGAFLDQDTQLSIVITKGARDGEVAISYDGSAEPIKLSVPNHGKSDSMVATIDGDLLSIH
RVRDNRMLSARRIVPKESILKGTSFQGIYHCAEIESTFHCLGQDGMLYGAFDGYLGQGNA
TPMKYLGDDVWVLTCPRGLDAPAPGDWTIAFSRDDRDAIQGCTIGCWLARKVDYVKKA
Download sequence
Identical sequences jgi|Pench1|39303|fgenesh1_pm.11_#_15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]