SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|24804|fgenesh1_pg.2_#_2159 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|24804|fgenesh1_pg.2_#_2159
Domain Number 1 Region: 157-560
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.4e-103
Family GABA-aminotransferase-like 0.0000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|24804|fgenesh1_pg.2_#_2159
Sequence length 644
Sequence
MEALLQQSRTMCPFLKRTSPTTLRTLSTATRPSPGGGTMSNLQVLGRRCPVMSKALAVQS
ARLSGTKRFTSRAAGVAGCQSLRVPTGKRALHTTGGHPASLASGGYEKNERGNPNLANPL
RSSPTAAGVGTAVRGPRPEAPANEKFNYGNFYNAELEKKHKDKSYRYFNNINRLANEFPR
AHTASAEERVTVWCSNDYLGMGRNPQVLDSMHKTLDTYGAGAGGTRNISGHNQHAVALED
TLAKLHGKEAALVFSSCFVANDATLATLGSKMPDCVILSDSLNHASMIQGIRHSGAKKMV
FKHNDLEDLEAKLASLPLSTPKIIAFESVYSMCGSIAPIEKICDLSDKYGAITFLDEVHA
VGMYGPHGAGVAEHLDYDVYASQDTASPQSTKGTVQDRIDIITGTLGKAYGCVGGYIAGS
AAMVDTIRSLAPGFIFTTSLPPATMAGADTAIQYQSQQPRDRILQQLHTRAVKTALSDLD
IPVIPNPSHIVPLLVGDAELAKQASDKLLEEHGIYVQAINYPTVPRGEERLRITPTPGHV
KPLREHLVQAVQAVWNDLGLKRTSDWKSQGGFVGVGVEGAEAANRPIWEDAQLGLQAGET
LEGAVAREFNDAAAQTAVPPLKAATPLTEKAYSGMNSTPVGVVA
Download sequence
Identical sequences jgi|Pench1|24804|fgenesh1_pg.2_#_2159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]