SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|67025|e_gw1.1.1649.1 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|67025|e_gw1.1.1649.1
Domain Number 1 Region: 1150-1233,1275-1392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-46
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 1422-1618
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.56e-33
Family BAR domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|67025|e_gw1.1.1649.1
Sequence length 1897
Sequence
MSSGDEQGFDVRYRDPPFGRQSSAPAFGQSANGHTTTSLDDSPTVSFSPQAQSSTTYSPL
PSGFIRPHNPSTSTNHLSSGDQLEDRSGRESPDPADYYRQRGSLPGTSNVREGFGDVRAG
MAAADYPTVGDKVSPLPTNVLESSRARRQPYRSTSDSPTLGAPSANIPPLYANPRSRQPS
FKDLVNKFNKTSDQILPLPSASRPTSRAPSPCGSADGERNRVLPRRRQYRDSLPESITSN
PRAPVDSTPSSPEADKFGPPLDTKSAIPLPLFQRITESHPRRPLFGELLPINTQVNNGVL
SRLQQRRGSDGSIPSPNPAFLEHRDQYPARSPLTPTAWYLGHTTSLEAVNPGINSTGKHR
RAQSDLDKIRKPLAEPWSPEMAVPAPLRQAKPGHESPPGSPNSGIKSRIPVSSHRLVAAS
GPESLSPSSNPTFSTRSAAITSPPKGSSRLPIPSPKQSPPRMPAEDPASFATNSHGRRDL
TIGRTRNQLSESSRRLQAYIAEPPPKKSPPLRSSRPRQPVSHGAAVSPRSKIGDRVLNLQ
KQATHSDSRSRPDRKLPELGKVDFDARRRHIQQAINRHSINSGVQANQNDRGPDRSTAAK
LRRHALVREQETQEGFKKSVDEPTITPALPVTNSPSPDEMATIVKESTGSVDCKENCVQA
VPKLHLNTALPASDMAAPHTTMDSPTLGLPQGVNPTTSGEGQPINGDPTESGATSDSDDT
HITTFDPEPQSGLLQRNPSVSHRTILDQIMQIRECSPSDDSCDEPDCSLSNDDRESIQIM
LGDTTYYNSSSSTNTQEIERASTHPAQNGTHLHNRWSMSSWSSGQNQHSTCDEHCSESGD
DSLLRGCETEPPTETCSAVSTRPASIADDESPLPIQDHGVMGPHTLQASEQFRPNAFSTP
PSLARLGRWDSKRVTQLYLEELTRGKGHHLGSAIYPSSEPRSHPSDTRTDGRPDSLTDDP
VVVPGYKASNISDRHSHTARLVGRDDWEHASPSIMDWMQIAAEDDAMTPDTETDGRRTEG
VLTPRLVPSTTHDAGASNTNNGLGVSVDIQASNEQTEPRAFPSSAFLPPSSTHQTDNEIP
GVQNPLKPSDHIGFDRSIQVAPRPAGHSPGSSQDSSFQNLESIQSPAAPDSSATSLVPST
EQTIRVERKDSPSPEQRRLKKRRHIIKELVDTEHTFGHDMIIIEDIYKSTSLTVLDPDDV
KVLFANSDQVAAFSDKFLRDLKQAAQSIYVMPKTLRWTSKRKRKNQHPESTTPSGDEVAE
LAGMSELEKDRATSVGQVFVGHMADMEKVYTEYLKNHDAANKKLQVLQRNSKVGFWLSEC
QKGAMDLTTAWDLDSLLVKPVQRILKYPLILRDLLDSTPNDHPDRAAIANALEEVTNVSH
RINELKKRVDLVGQAVGRKRNQSDVRAGLSKAFGRRTEKFRQQVGLSDLFEDKTYDSLAQ
KLSDGYFQLQVVMRDAESYSRDVQLYVNQFNEYADSIEEVVGMSPSPYPQLESKWHQFKM
TVQELVTTALPEHVAVVRKTVIDPMVELLGLYNAPQRVMRKRDKRLPEYARYKAIKDRGD
KPDKKTTEQGEQFLALNDTLKDELPKLYALTTKLMTACLKNFVQIQTVWYSILQKKIGVH
VELFPNDLDRLISDFNSDHHLMEARMGELGSCNGALMAHSLNLVPLSPSEQQNPMSPRRP
STVNSSNARPGSMTGDSPNVSRDFSVGSQSFQSPQMESHSSRSSRYRADSIMSGRVVPDT
PNQLLQQAISSPAPARTSDVEPFPSLPRLSLDTPFLEDVINSSSHSSNAPTSPTDRYSGF
FSSAMPMSDVPSDTVVDGHFERSPPPVGPAPLFCAASVYDFNIDSRTEGGYPYLTYASGD
IFDVIGEKGELWLARNQDDAAGTVGWIWNKHFARLGS
Download sequence
Identical sequences jgi|Pench1|67025|e_gw1.1.1649.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]