SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|67525|e_gw1.1.4879.1 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|67525|e_gw1.1.4879.1
Domain Number 1 Region: 18-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000154
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 76-113
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000153
Family Zn2/Cys6 DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|67525|e_gw1.1.4879.1
Sequence length 725
Sequence
MSKHSLTGSPETSETSKYECSLCPKRYKRREHLFRHISSHTSQRPYQCHSCDGAFQRADV
LKRHLRTCDGGASRASTRRRACDRCVRQKKACSSHQPCHSCAKRGAHCWYATDTGPSPRP
SQHSPAKDIPKDQDMNAQFTDPPPPPSASNTMMPWGFTLEDLQSFGTSPIDTFLDPASMQ
CASPIWPNFSALAPETPATFEPVSSDNPRKSLHFLDKFTSNTGLVSSFDCGTQEQREQVA
ASLDQQILSQLRQRIMSMPALSMDVPSLVLENNSDTSSTSDLTLDWFNDPLSLKTHEILL
LIEEVVTIKPRNSSVTLDWSSALRDACLQFFSPSNIRRFLGFYWAIWHPNVNFVHRPTFD
MLAAKPTVLAAMALIGACVSPDMPDNEDARTWFNCVEEMVFIDDDFNSDLAYQSSGDMAI
QRRKIQAVQAAYIVCLYQNWEGTDASKSRIRRYRFATLVSTARDISITAARHLNYSEQGR
HEFEWKEYAAREELIRVFTWIFLLDSAFVIFNNLPPRMVIKEMRMHMATPEACFQATTAD
QCHHQLQLFLPARSLYWTISLRGSFESICKDDLSVNIRHLLATLGPLNLFALTSGIHSQI
FQFRSAVGSFQLRAPIQNALSNWRDIWHLFSSTFPQGVMPHMTIEDPHIQPEDLWRRMGF
CRYSPEYWLLAHLMADRLAVRGTSKTENELEPLDEGPLDPILNRYDQTSMRQVNDLIMGF
QTFQI
Download sequence
Identical sequences A0A167SEF6 B6HFR7
jgi|Pench1|67525|e_gw1.1.4879.1 XP_002563125.1.37043 Pchr_Wisconsin_54-1255:Pc20g05960.t1 500485.B6HFR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]