SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|72484|e_gw1.2.5114.1 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|72484|e_gw1.2.5114.1
Domain Number 1 Region: 192-608
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.4e-95
Family GABA-aminotransferase-like 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|72484|e_gw1.2.5114.1
Sequence length 671
Sequence
MPRRFSSNSSNDTSTNPPSFSPSSGKGGISIKAPTVKSNRLSQLFSASPKSKTETVQSGH
SQPSNSSPPISLASLSLPTISLSTATADNPNMDELPTTLFQPPSPEEARRLAKQHAQFGP
IGHPSHRYSSRHPGGVFPEPVMDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREEHYR
HLKPRNGYGALNSDFDNFYVRRLKLRINDCFERPVTGVPGRTITLIDRATDDHNQHFYLT
GTTTDTLNLSSYNYLGFAQSDGPCADIAEDSIKKYGIAAPSTRAESGTQDLHVEVEDLVA
RFVGKESSMIFSMGFGTNATIFPALVSKGCLLISDELNHASIRFGARLSGASIAMFKHND
MKDLELKLREAISQGQPRTHRPWKKILVVVEGLYSMEGSMCNLPGLVQLKRRYKFNLFVD
EAHSIGAIGPKGRGVCDYFSIDTSEVDILMGTLTKSFGANGGYIAADKVMIDALRATNPG
VYYGESPAPAVLAQISSALRIINGELVPGQGEERLQRLAFNSRYLRLGLKRLGFIVYGHD
DSPIVPVLLFNPAKMPAFSHEMLRRKISVVVVGYPATPLVSSRARFCVSAAHTKEDLDRV
LTACDEIGNVLQLKFSTGIAGGALPAAEQPAPPPELEKEWHRRRSDNISPPRWRVEDVIR
RGVQDVKNPLY
Download sequence
Identical sequences A0A167XVQ2 B6H416
XP_002559500.1.37043 500485.B6H416 jgi|Pench1|72484|e_gw1.2.5114.1 Pchr_Wisconsin_54-1255:Pc13g10800.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]