SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472328798|ref|YP_007661074.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472328798|ref|YP_007661074.1|
Domain Number 1 Region: 32-188
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.72e-48
Family Phosphate binding protein-like 0.0022
Further Details:      
 
Domain Number 2 Region: 188-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1e-27
Family Phosphate binding protein-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472328798|ref|YP_007661074.1|
Sequence length 293
Comment glycine betaine ABC transporter (glycine betaine-binding lipoprotein) [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYD
LNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEES
HTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPSKVAAEYVNKHKDQIAEW
TKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSAD
ASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK
Download sequence
Identical sequences gi|472328798|ref|YP_007661074.1| WP_015482763.1.3747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]