SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472329411|ref|YP_007661687.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472329411|ref|YP_007661687.1|
Domain Number 1 Region: 28-267
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.53e-57
Family Phosphate binding protein-like 0.0000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472329411|ref|YP_007661687.1|
Sequence length 276
Comment hypothetical protein I653_04585 [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MKKWLICSFALVLLVSFTACSPSAEHESIKIGIAESDGAIWNYIAQKAEEAGLDIQLIPF
SDYAESDIALANKEIDANAFQTISYFQSFTQKYKLNLAPLGTTYITPVGIYSKRYDRIRD
IPRGAVVSVPDKAFDFGRALTVLQEAGLLTLKNGFNGTGSVDMIKDNPRHLKLKAVRQQD
AVSGADVFVMKPSEAKKAGLNPKKHTLKSGGLMSEEEMNLIVVRAEDQDREALQTILELY
QADDTAAFIEKEYQGDLVPAFLPLKRLSDWKNEFVH
Download sequence
Identical sequences A0A2J0WJB4
gi|472329411|ref|YP_007661687.1| WP_015482994.1.31260 WP_015482994.1.3747 WP_015482994.1.54949 WP_015482994.1.91133 WP_015482994.1.99091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]