SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472330781|ref|YP_007663057.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472330781|ref|YP_007663057.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.28e-69
Family Phosphate binding protein-like 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472330781|ref|YP_007663057.1|
Sequence length 255
Comment High affinity arginine ABC transporter binding lipoprotein [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MKKWLLLLVAACITFALSACGSSNSGSEGGKKKLIMGTSADYKPFEYKEGDNIVGFDVEL
AKSLAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYYTANHM
IVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKTEDRNRISDLVQEIKSDR
FDAAIIEDIVAEGYFKSNDDLQGFVIPDAKAEEAGSAIAFRKDSELTDKFNKALKEMEDN
GELEKLKKKWFTGEK
Download sequence
Identical sequences M4KZ51
gi|449094895|ref|YP_007427386.1| gi|472330781|ref|YP_007663057.1| WP_015384047.1.31260 WP_015384047.1.3747 WP_015384047.1.54949 WP_015384047.1.91133 WP_015384047.1.99091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]