SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472331086|ref|YP_007663362.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472331086|ref|YP_007663362.1|
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-71
Family Phosphate binding protein-like 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472331086|ref|YP_007663362.1|
Sequence length 273
Comment glutamine ABC transporter (glutamine-binding lipoprotein) [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MKKIFSLALISLFAVILLAACGSKGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFG
LKNPSSGEIEGFDIDIAKQIAKDILGDEKKAEFKEVTSKTRIPMLQNGDIDAIVATMTIT
DERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEAS
VLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQS
ALAKEINASLKKMKSDGRYDEIYKKWIKEDPAE
Download sequence
Identical sequences A0A2J0WGD4 M4KTT1
gi|449095183|ref|YP_007427674.1| WP_015384233.1.20502 WP_015384233.1.31260 WP_015384233.1.3747 WP_015384233.1.54949 WP_015384233.1.91060 WP_015384233.1.91133 WP_015384233.1.99091 gi|472331086|ref|YP_007663362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]