SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472331409|ref|YP_007663685.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472331409|ref|YP_007663685.1|
Domain Number 1 Region: 33-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.84e-34
Family Transferrin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472331409|ref|YP_007663685.1|
Sequence length 334
Comment putative binding protein [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MNRWLRLGFACVGSIFLMIALAACKQEETLTKVKVAEVTHSIFYAPLYVAESKGFFKEEG
LDVDVNTTWGGDKTMTSLLSNGSDIALVGSETSIYVEAQGAKDPVINFAQLTQTDGTFLV
AREDVEHFDWDQLKGKTFLGQRKGGMPQMVGEYVLNKHKIDPHKDIDLIQNIDFANIANA
FASGTGEYVQLFEPQASLFEKKGIGHIVASFGEESGEVPYTTFMAKQSYLKKNEDTAVKF
TKAIYKAQQWVENHSAKDITDAIKDEFDDTDPDVIETSIERYKKQHSYSPDPLLNEKEWE
LLQTIMDQSGELPKHIPYNQLVNKEIAEKVTSEK
Download sequence
Identical sequences gi|472331409|ref|YP_007663685.1| WP_015483593.1.11088 WP_015483593.1.12644 WP_015483593.1.31260 WP_015483593.1.3747 WP_015483593.1.54949 WP_015483593.1.69439 WP_015483593.1.71402 WP_015483593.1.7159 WP_015483593.1.87300 WP_015483593.1.91133 WP_015483593.1.99091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]