SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472331746|ref|YP_007664022.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472331746|ref|YP_007664022.1|
Domain Number 1 Region: 34-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.52e-69
Family Phosphate binding protein-like 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|472331746|ref|YP_007664022.1|
Sequence length 305
Comment Glycine betaine/carnitine/choline-binding protein OpuCC [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MKMTKIKWLGAFALVFVMLLGGCSLPGLGGASDDTIKIGAQSMTESEIVANMIAQLIEHD
TDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNE
FQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGD
GYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFF
PPYDCSPVIPEKVLKAHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEK
HHYFD
Download sequence
Identical sequences A0A125UMK7 A0A2J0WK97
gi|430758092|ref|YP_007208115.1| gi|472331746|ref|YP_007664022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]