SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518651662|ref|YP_008141182.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518651662|ref|YP_008141182.1|
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily RibA-like 1.06e-59
Family RibA-like 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518651662|ref|YP_008141182.1|
Sequence length 192
Comment GTP cyclohydrolase II [Ferroplasma acidarmanus fer1]
Sequence
MIEFYAKAKLPTRFGVFNIYVFKNEDKKDHAVLVHGDIEEEENVPVRIHSECLTGDVFGS
MRCDCRDQLITSLKYIGSRERGMLIYLRQEGRGIGLLNKIRAYNLEDNGKDTVEANIEQG
LPADNRHYNFAIDVIKYFNIKSIELMTNNPEKIKNLEENGIKISKRIPVIIEPNSFDKFY
LETKKDKMGHML
Download sequence
Identical sequences S0AMT8
gi|518651662|ref|YP_008141182.1| WP_009886323.1.98901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]