SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518652012|ref|YP_008141532.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518652012|ref|YP_008141532.1|
Domain Number 1 Region: 251-438,805-988,1019-1094
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.94e-146
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 437-556,724-803
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.06e-36
Family Intein (protein splicing domain) 0.012
Further Details:      
 
Domain Number 3 Region: 635-753
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000765
Family Intein endonuclease 0.036
Further Details:      
 
Domain Number 4 Region: 11-164
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.00000000000419
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|518652012|ref|YP_008141532.1|
Domain Number - Region: 220-250
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.00654
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518652012|ref|YP_008141532.1|
Sequence length 1136
Comment hypothetical protein FACI_IFERC00001G0651 [Ferroplasma acidarmanus fer1]
Sequence
MNKVLNTVIKRDGSSVPFDKKKIAMAIFKAMLSVKIGSMEEANKLADYVAQELETSSEVP
TVELIQDTVEKVLMTRRINDVSYIAAAKAYILYREKRNTIRQEKEFIGVKDDLKLSLNAV
KVLEARYLFKDSEGKIIETPKQMFHRVAVHLGIIQGLYDYISYRKTGKLNEKGTVYSGIT
KTQNEELERAFNELKKEKAIDGTYTEFIDFIKTKKNMINYWIEKFENMMIKLEYVPNSPT
LMNAGGPLGQLSACFVLPVDDSIDSIFDTLKATAEIHKSGGGTGFSFSRLRASDDIVAST
KGVASGPVSFMRIFDVTTDVIKQGGKRRGANMGILNYNHPNIMDFINSKDAENKILSNFN
ISVGVNDEFFEKLDNDENVDLINPRDGKVTGRVKATTLWNSIIDHAWLTADPGMIFLDEI
NKKNPVKNIGYIESTNPCVTGDTKIFTSEGVKKARQLYEEGNPLNVKIDGRFGGEFKPSS
NVIYTGFKDIYKIQTKEGFEIKVTGDHKIYSEKNGWTEALNLKENEKIRILNEGGSFGSS
GTLEEGRVLGWLVGDGHINNGNNNDRAVLNFYSQDRVFADTFRKYVNDIVRPATNNREYN
VGMVNIESRNCITIASERLKEFASEYDLIEEKLNVPDKVFAGSMELQRGFLQALFEADGT
VYSGQKSRHSVRLGSISLNLLKQVQMLLLNFGIYSRIYQNRKKAGMRMLPDSNREMRLYA
TQDFHELNISAENLIKYADSIGFISERKNSKLNGAVNSYKKAPVKPSWLARVDKIEYVGR
EDVYDLVEPSTHSFVANGIVVHNCGEQPLLPYESCNLGSINLAKFVEDGKFNYERYRETI
DVATRFLENVVDANKFPVESIKNMTRKTRKIGLGIMGFADALIMLGIPYNSNEALEFAEN
VMKTLNDESHMESQKLAAERGVFPGWYGSEYEEKGIKMRNSTTTTIAPTGTISIIAGCSS
SIEPLFALAFVRHVLNGQELLEVNPLLENALKSRNLWTQELMEKIAETGKLGNLDLPEDV
KNLFITAQEIDPDWHVLMQATFQKYCDSGVSKTINLPFDATREDIAKSYRLAKELHCKGI
TVYRDRSKSQQVLYAGTNQKKSDEEHKIDLTMKMPDKLLKLGATFDPACPTGKCDL
Download sequence
Identical sequences S0ANZ6
gi|518652012|ref|YP_008141532.1| WP_009886680.1.98901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]