SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518652467|ref|YP_008141987.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518652467|ref|YP_008141987.1|
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.62e-20
Family Prokaryotic DNA-bending protein 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518652467|ref|YP_008141987.1|
Sequence length 90
Comment DNA-binding protein [Ferroplasma acidarmanus fer1]
Sequence
MVGISELSKKVASTTNTTQKKTAEIITAFLKETVESVNAGNKVNLADFGIFERKEQKERV
ARNPKTREEIKVPAKDKFVFRASSAIKYKD
Download sequence
Identical sequences A0A1V0N1U2 S0AQ66
gi|518652467|ref|YP_008141987.1| WP_009887139.1.63474 WP_009887139.1.98901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]