SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518652628|ref|YP_008142148.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518652628|ref|YP_008142148.1|
Domain Number 1 Region: 39-198
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000000000804
Family Clp protease, ClpP subunit 0.016
Further Details:      
 
Domain Number 2 Region: 368-436
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000458
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518652628|ref|YP_008142148.1|
Sequence length 436
Comment hypothetical protein FACI_IFERC00001G1267 [Ferroplasma acidarmanus fer1]
Sequence
MTKPKGLIIVLIIFIFLLMVASSAGHSTGQTENSYKAGNGKVVLFINLTGTVSAGTTNMF
RSELSNIDNSSVKAVIISVDAGGGMLQQALDIDKYINSTENKGINVYAYVLPGGSATYTA
TYVTMDATGLYMAPGTMIGLSQPDLVGGTSTQEQNDIIQMGHVMESMALAHNRNGTAASS
MVLNDSEYSSAQASNIKLSDGNFASMNAMLAGLNLSAYGKEYVHQSVYDNFLGFIANPLI
AGIFILIGIVAVFLDLYHGTIVLSVIGVVMIGLGLLGADIINASIFGLILLLLAGILIFL
EFKTNHGIALLSGLITGIAGIYFLASSYGTSSPGYSPAPFGESFYMFSIAIILIGILLII
YISKILKSQRREIYTGAESLKGHSADVVTPMKRNEKGFVMIDGVQWEAINIGVDVNRSEK
VVIIERKGLTLIVKKI
Download sequence
Identical sequences S0AR47
WP_009887300.1.98901 gi|518652628|ref|YP_008142148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]