SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518652833|ref|YP_008142353.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518652833|ref|YP_008142353.1|
Domain Number 1 Region: 48-115
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000562
Family NfeD domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518652833|ref|YP_008142353.1|
Sequence length 117
Comment hypothetical protein FACI_IFERC00001G1472 [Ferroplasma acidarmanus fer1]
Sequence
MFTEIIPVDYTTAVPGSLVFAVILVIIVLVVIITVTVYYLYKIISSQRGRKYTGSESMTN
IIGIASNNIDKNAGGFIKIDGVSWEVINNGDEPIEKYDKVVVTGRIGLKLMVKKIKK
Download sequence
Identical sequences A0A1V0N2J2 S0ARN4
WP_009887507.1.63474 WP_009887507.1.98901 2005151253 gi|518652833|ref|YP_008142353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]