SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518651535|ref|YP_008141055.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518651535|ref|YP_008141055.1|
Domain Number 1 Region: 596-829
Classification Level Classification E-value
Superfamily Stabilizer of iron transporter SufD 6.28e-77
Family Stabilizer of iron transporter SufD 0.00063
Further Details:      
 
Domain Number 2 Region: 45-245
Classification Level Classification E-value
Superfamily Stabilizer of iron transporter SufD 8.89e-48
Family Stabilizer of iron transporter SufD 0.036
Further Details:      
 
Domain Number 3 Region: 242-382,533-598
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.45e-31
Family Intein (protein splicing domain) 0.021
Further Details:      
 
Weak hits

Sequence:  gi|518651535|ref|YP_008141055.1|
Domain Number - Region: 374-453
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000744
Family Group I mobile intron endonuclease 0.044
Further Details:      
 
Domain Number - Region: 462-556
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00133
Family Group I mobile intron endonuclease 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518651535|ref|YP_008141055.1|
Sequence length 835
Comment hypothetical protein FACI_IFERC00001G0174 [Ferroplasma acidarmanus fer1]
Sequence
MEDYNKDEEIEKLTESLKHNKKSDFEFHDTINPVYSTGTGLNRKTVEEISDIKHEPDWMR
RSRLKALDIFLSKPMPTWGPDLSGINFDELTYYSKPGETKAKNWDDVPDKIKETFNKLGI
PQMEQKYLAGSVAQYDSEGVYGSLRKEWEDKGVIFTDLDTAVQEHPDLVKDYYCRAIPPS
DNKFAALNGAVWSGGSFLYVPKNVTIDMPLQTYFRMNGEQSGQFEHTIVVADEGAKVHYI
EGCLPEDELISQGDKFVPINELLTDDSVVSNTGNQRKITRKYVHPYSGLMYKITPLSPGN
AFRATSEHPVLSIKKEDVTSRIRDGHYEISTKKLMEAIPEYRRMDELSEGDFIVYVSPVE
TEDDASIDEDMLKILGLYTAEGSISFNKSLNLYQMSFSFGLSAKEEKIAYELYNIIKEKG
ERANIFKADKKYYTVSTYSKTLIDFCLNNAGKYADKKAFSEKIMKLPPEKQKLLIDYYLK
GDGNVYIKKGKSKMIRAGTASKILALQLQEMLSRNNTFASIMIRKASDDVILGRNIKRKE
QYIVEYTENIKFSRVRHKDNYYYVPIKKMEAEVYDDIVYNMEVETDDSYLVKGFAVHNCT
APKYNTSSLHTAIVEIYARKNSDVKYTSVQNWSDSVYNLPVKRAWVDENAHMDWVTGELG
SKVTMIYPSSYLRGRGASTSNLQITLATKDTFKDAGGKALHLAPDTTSRIVSKSISLDNG
LTAYRGLVRMNEGAKRAKSHVQCDALLINSDSKNYTYPYDEIYEPTAEFSHEATVGKIGT
DELTYLRSRGLSEDEASSMIVLGFMDDIMKEIPMEFAVEMNRLVKLEMSKMGAVG
Download sequence
Identical sequences S0APM7
gi|518651535|ref|YP_008141055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]