SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm10909 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm10909
Domain Number 1 Region: 98-165
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.7e-26
Family Cyanase C-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 18-95
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.8e-22
Family Cyanase N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm10909
Sequence length 165
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3:356093:357415:-1 gene:WBGene00231170 transcript:Bm10909 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm10909 description:Cyanate hydratase [Source:UniProtKB/TrEMBL;Acc:A0A0J9Y2G5]
Sequence
MRRSIANVLEGSGIISVEVMKSRQDVTNLILATKVQKGVTWKSVAEKIGKSKEWTTAACL
GQMVMSKEQAEKVAEIFDLPESALLWLQTVPQKGTPGIPSDPILYRLHEVIAVYGPTIKE
LIVEEFGDGIMSAIDFNLTVAREKNEQGDRVSLVLSGKFLPYKEF
Download sequence
Identical sequences A0A0J9Y2G5
Bm1_27775 XP_001897006.1.25112 Bm10909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]