SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm14072a from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm14072a
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.59e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00057
Further Details:      
 
Domain Number 2 Region: 52-103
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000000128
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm14072a
Sequence length 111
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold29:365788:366712:-1 gene:WBGene00234333 transcript:Bm14072a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm14072 description:Transcription initiation factor IIA subunit 2 [Source:UniProtKB/TrEMBL;Acc:A0A0J9XVN2]
Sequence
MSYQLYRSTTLGIALRSTLDEFVEDGTITPSLAQTVLTTFDKCINRALSQRVKNKVNFKA
DKLKAYRFCDNVWTFVMENVEFRDVTQPVDGVVDRVKIVACDASAAKLANT
Download sequence
Identical sequences A0A0K0J061 J9EXI3
WUBG_02180T0 Bm14072a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]