SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm4517 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm4517
Domain Number 1 Region: 55-285
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 3.14e-78
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 3-55,290-489
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.11e-62
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm4517
Sequence length 492
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold255:1418:6766:-1 gene:WBGene00224778 transcript:Bm4517 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-ipgm-1 description:2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Source:UniProtKB/Swiss-Prot;Acc:Q4VWF8]
Sequence
XNAILNAKTPVMDELCVMNSHPIQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI
NLAVKNKTLVENKHLKEAAERAIKGNGRMHLCGLVSDGGVHSHIDHLFALITALKQLKVP
KLYIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKRWERIRVCY
DALIGGVGEKTTIDKAIDVIKGRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRM
REITECMGMERYKDLNSNIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNG
LTQFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIE
QLHMKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADH
GNAEKMMAPDGSKHTAHTCNLVPFTCSSMKYKFMDKLPDREMALCDVAPTVLKVMGVPLP
SEMTGQPLVNEA
Download sequence
Identical sequences Bm4517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]