SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11648b from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11648b
Domain Number 1 Region: 33-102
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.000000000000759
Family Protein serine/threonine phosphatase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm11648b
Sequence length 103
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold8129:15:986:-1 gene:WBGene00231909 transcript:Bm11648b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11648
Sequence
MPKMTTTTSNDSALSTISKSPSTANVIEVPPVDLDYIFAHMMTIGRPNTGISTCITEQDI
TDLLLNVKSLFMEQPVMLKLKPPITVCGDIHGQFGDLIRIFSK
Download sequence
Identical sequences A0A1I9GA95
Bm11648b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]