SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm1770d from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1770d
Domain Number 1 Region: 465-853
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.3e-125
Family Ankyrin repeat 0.00000000157
Further Details:      
 
Domain Number 2 Region: 153-480
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.32e-88
Family Ankyrin repeat 0.000000654
Further Details:      
 
Domain Number 3 Region: 76-180
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.46e-26
Family Ankyrin repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 1466-1555
Classification Level Classification E-value
Superfamily DEATH domain 9.08e-16
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1770d
Sequence length 1800
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold25:253051:270913:1 gene:WBGene00222031 transcript:Bm1770d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-unc-44
Sequence
MFLLSSWYMVTKRSARGHITGSTTDKKRVTNKTQLLMINPAVEAGGWPAEVPKSQQQQVP
SDNSQHSNKGESSASFLRAARAGNLDRVLELLRLGTDINTCNANGLNALHLASKEGHHEV
VRELLKRKADVDAATKKGNTALHIASLAGQELIVTILVENDANVNVQSLNGFTPLYMAAQ
ENHESVVRYLLAHSANQALATEDGFTPLAVALQQGHDRVVALLLENDTRGKVRLPALHIA
AKKDDTKAATLLLQNEHNSDVTSKSGFTPLHIAAHYGNENVALLLLEKGANVNYQARHNI
SPLHVATKWGRANMVSLLLAHGAVIDCRTRDLLTPLHCASRSGHDQVVDLLLEKGAPINA
KTKNGLAPLHMAAQGDHVDSARILLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR
NADSNARALNGFTPLHIACKKNRIKVVELLLKYHAAIEATTESGLSPLHVAAFMGAINIV
IYLLQQGANANVATVRGETPLHLAARANQTDIVRVLVRNGAQVDAAARELQTPLHIASRL
GNTDIVILLLQAGASPNAATRDLYTPLHIAAKEGQEEVAAILIDHGSDKTLLTKKGFTPL
HLAAKYGNLPVAKLLLERGTLVDIEGKNQVTPLHVAAHYNNDKVALLLLESGASAHAVAK
NGYTPLHIAAKKNQMDIASTLLHYRANANAESKAGFTPLHLSAQEGHREMAALLIENGAK
VGAQARNGLTPMHLCAQEDRVNVAEELVKENAATDSKTKAGYTPLHVACHFGQINMVRFL
IEHGAPVSATTRASYTPLHQAAQQGHNNVVRYLLEHGASPNVQTSTGQTPLSIAERLGYV
SVVEALKTVTETTVITETTTITEERYKPQNPEAMNETMFSDSEDEGDDNQITANAHAHDF
SESLTKGLHDSTGVHLIHATEPMLSKSPEVEGVDGDLDALIRKAQHEPVTTAMVDPSLDS
SLSDSVPVTRTTVQPSFLISFMVDARGGAMRGCRHSGVRIIIPPRKAPQPTRVTCRYLRK
DKLAHPPPLSEGEALASRILEMAPHGVKFLGPVILEVPHFASLRGREREIVILRSDDGQH
WKEHQLEATEDAVQEVLNESFDAEELSQLDDLHTSRITRILTNDFPMYFAVVTRVRQEVH
CVGPEGGVILSSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEIVARLHGNRVAVSPIVTV
EPRRRKFHKPITLCIPLPQSSNKGMLTQYSGQPGQEPPTLRLLCSITGGSAPAQWEDITG
TTQLTFTGEDVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISVPYMARFLIFARRTF
PNEGQLRLFCMTDDREDKTLEKQEHFIEIAKSKDVEVLSGRHQFLEFSGNIFPITKSGDQ
LSLYFLPFQENRLAFMIKTRARTDNEAAADGRISFMKEPKMRAESLPPQTPLCTLAVTLP
EYTGPISKKPFFSEALLTEKYTEALHETAEPDDLPLPHVARLIGADWHRLARALEVPDID
IRQVRHQLVGLEAITVLRIWMFLKKEQATPAILRSALQRIGRDDVVREINRIEKPDDLEG
TPVSHISEPSVTISSTSLEADDRRHYSEVAATQQLMVEEPFFQQSEYYGIDGDTGGPKEQ
PFREEEEEVAVSEIRTVVRTERHVHDSEDGERCFDTGPIVEERTITTTYEDDVAVNEEIV
DRIVPLNEEEQEKWDRMVREAEMNLEQQKESKEGTLDSQVTHEEKKDGDDGVILKTTRMG
SSHVSQFLPDEAKTAANETGLSSRDASIVMTPTGEEKVDHIDVMEEKRTDEEAKGQNVHE
Download sequence
Identical sequences A0A0K0J308
Bm1770d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]