SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm6611a from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm6611a
Domain Number 1 Region: 97-172
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.76e-33
Family Skp1 dimerisation domain-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily POZ domain 7.53e-22
Family BTB/POZ domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm6611a
Sequence length 174
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold142:42809:44675:1 gene:WBGene00226872 transcript:Bm6611a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-skr-2
Sequence
MSEQKPAQQKISLISSDNETFEVDRNVIRLSTTINTMLQDLGMDNQDGGDIDMVEGIPLQ
SVNSAILKKVIHWCEYHKDDPIPPEDNDNKEKRTDDISSWDVEFLKVDQGTLFELILAAN
YLDIKGLLDVTCKTVANMIKGKSPEEIRRTFNIKNDFTPEEEEQIRKENAWCED
Download sequence
Identical sequences A0A1I9G098
Bm6611a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]