SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386323750|ref|YP_006019867.1| from Shewanella baltica BA175

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386323750|ref|YP_006019867.1|
Domain Number 1 Region: 18-133
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.13e-16
Family Phosphate binding protein-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386323750|ref|YP_006019867.1|
Sequence length 136
Comment hypothetical protein [Shewanella baltica BA175]
Sequence
MKKLLCSILLSLLSMPLFAGVVVIVNPSNADAIDQKSIENIFLGKTKTFPGGAQAVPVNL
DSAMPLRETFDTKVLGKSSSQLKSYWSQKVFTGKGTPPKEVTSGAEMIKLVASNPNIIGY
IDSSEANDSVKVIAEF
Download sequence
Identical sequences G0AQ10
WP_006082554.1.19221 WP_006082554.1.35668 gi|386323750|ref|YP_006019867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]