SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004537 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004537
Domain Number 1 Region: 13-215
Classification Level Classification E-value
Superfamily vWA-like 4.19e-56
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 215-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000718
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004537   Gene: ENSMMUG00000003402   Transcript: ENSMMUT00000004811
Sequence length 255
Comment pep:known chromosome:MMUL_1:10:19147305:19149495:1 gene:ENSMMUG00000003402 transcript:ENSMMUT00000004811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLCWLVLLFLLQPWESQLQLAGPRCHTGPLDLVFVIDSSRSVRPFEFETMRQFLVGL
LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYA
MNVAFSVAEGARPPEERVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADVGS
LRAMASPPLDEHVFLVESFDLIQEFGLQFQSRLCGKDQCAEPGHGCQHQCVNALGTFHCT
CNLGYKLAADNKSCL
Download sequence
Identical sequences ENSMMUP00000004537 ENSMMUP00000004537 9544.ENSMMUP00000004537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]