SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014449 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014449
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 4.18e-24
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014449   Gene: ENSMMUG00000011035   Transcript: ENSMMUT00000015425
Sequence length 289
Comment pep:known scaffold:MMUL_1:1099214805331:546:1615:1 gene:ENSMMUG00000011035 transcript:ENSMMUT00000015425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AILEKLTLYWAYPFVRYALIVGVLIALCSSLLGVTLVLKRFSFIGDGLSHVAFGAMAIAA
VLQITNKMPLVMGITILSAVLLLRTGQNTKIKGDAAIAMISVGALAVGYLLMNIFSTSSN
LSGDVCSTLFGSTSILTLSPAEVWLCVGMSVLVVAVFILFYNKIFAVTFDESFARAAGTK
AGLYNLLIAVVVAVIIVLAMNLVGSLLISALVIFPALSAMRMFKSFRSVTICAAVLSVFC
ALLGILASILAGTPVGSTIVAVQIGTFGLSWLAGTVLDNYIGKTVKMQG
Download sequence
Identical sequences 9544.ENSMMUP00000014449 ENSMMUP00000014449 ENSMMUP00000014449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]