SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020378 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020378
Domain Number 1 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020378   Gene: ENSMMUG00000028810   Transcript: ENSMMUT00000021784
Sequence length 85
Comment pep:known chromosome:MMUL_1:19:23077601:23096180:1 gene:ENSMMUG00000028810 transcript:ENSMMUT00000021784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPPRGLEMGLLTFRDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPD
LITCLEQGKEPWNMTQHEMVDESPG
Download sequence
Identical sequences G7PX43
ENSMMUP00000020378 ENSMMUP00000020378 9544.ENSMMUP00000020378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]