SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024055 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024055
Domain Number 1 Region: 24-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-19
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024055   Gene: ENSMMUG00000029158   Transcript: ENSMMUT00000025714
Sequence length 140
Comment pep:known chromosome:MMUL_1:20:28598030:28599937:-1 gene:ENSMMUG00000029158 transcript:ENSMMUT00000025714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLAPLPSRDPNGAVPEWRKPRTVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYG
HLGALGESPTCSPGPCAPTRPAAPLGAARGVGGPGAGQAASPQRGVCVLLPQESEAASRR
SSPGWRRRPNYGIQLPGIRR
Download sequence
Identical sequences F7HHR7
ENSMMUP00000024055 9544.ENSMMUP00000024055 ENSMMUP00000024055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]