SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026201 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026201
Domain Number 1 Region: 356-532,567-733
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.42e-82
Family YicI catalytic domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 1224-1387,1468-1629
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.72e-71
Family YicI catalytic domain-like 0.00044
Further Details:      
 
Domain Number 3 Region: 111-355
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.69e-47
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 977-1221
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.66e-44
Family YicI N-terminal domain-like 0.0082
Further Details:      
 
Domain Number 5 Region: 1632-1712
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.37e-19
Family Putative glucosidase YicI, domain 3 0.0098
Further Details:      
 
Domain Number 6 Region: 736-816
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-17
Family Putative glucosidase YicI, domain 3 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026201
Domain Number - Region: 78-135
Classification Level Classification E-value
Superfamily Kringle-like 0.0785
Family Kringle modules 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026201   Gene: ENSMMUG00000016273   Transcript: ENSMMUT00000028007
Sequence length 1756
Comment pep:known chromosome:MMUL_1:3:179420764:179532647:1 gene:ENSMMUG00000016273 transcript:ENSMMUT00000028007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKLQKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTDDVETHRAPDPGTTGTPD
PGTTTSTQSRTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP
QGAVSVPWCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSN
RFHFKLTDQTSSRFEVPHEHVQSFSGNAAASLTYRVEISREPFSIKVTRRSNNRVLFDSS
IGPLLFANQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFKRDTTPNGNGSNLYG
AQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQ
EYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERR
DFTYDPVNFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSS
DGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSV
SGCSTNNLNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTV
FPNNRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF
ALDAPEELCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLP
YLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYV
PDAVWYDYETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLI
IALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNE
IKILGTEEPSNVTVKHNGIPTQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKIRDD
EKIDCYPDENGASAENCAARGCIWEASNSSGVPFCYFVNDLYSVSNVQYSSHGATADISL
KSSVYANAFPSTPVNPLHLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQ
LYDVLIKKNPFGVEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTS
YRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLP
ALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIAS
LYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAIS
GNETQPYPAFTRGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVEVKGSLEE
FLDVFQMLGRSTWEAEAGELLERRRQSSQGWHLQGLLDDMNEPSSFVNGAVSPGCRDTSL
NRPPYMPYLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVT
GQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQ
DAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDTAFVNISRNVLQTRYTLLPYLYT
LIYQAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRAR
WYDYYTGVDIDARGEWKTLPAPLDYINLHIRGGYILPWQEPAVNTHLSRKNPLGLIIALD
ENKEAKGELFWDDGQT
Download sequence
Identical sequences ENSMMUP00000026201 ENSMMUP00000021381 9544.ENSMMUP00000021381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]