SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001060 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001060
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.34e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 203-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.58e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001060   Gene: ENSMMUG00000000785   Transcript: ENSMMUT00000001131
Sequence length 411
Comment pep:known chromosome:MMUL_1:12:82907823:82913853:-1 gene:ENSMMUG00000000785 transcript:ENSMMUT00000001131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARLRPRLHFCLLLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTF
SDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
Download sequence
Identical sequences A0A0D9R7S2 A0A2K5KQ34 A0A2K5TS65 F6RAT8
ENSMMUP00000001060 ENSMMUP00000001060 XP_001092385.2.72884 XP_005574392.1.63531 XP_007964524.1.81039 XP_011918265.1.92194 9544.ENSMMUP00000001060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]