SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003303 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003303
Domain Number 1 Region: 216-508
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.31e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 23-205
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.35e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003303   Gene: ENSMMUG00000002453   Transcript: ENSMMUT00000003494
Sequence length 593
Comment pep:known chromosome:MMUL_1:14:26250528:26289075:-1 gene:ENSMMUG00000002453 transcript:ENSMMUT00000003494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVATAAAVAPAPAPGTDGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWF
AASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYD
SEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLERIIELNGQKPPLTYKRFQAIISRME
LPKKPVGSVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARL
DKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNST
PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESIQKAAKCI
IGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQ
AGSVNSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRAKVAELPTPELPSKDA
Download sequence
Identical sequences A0A2I3NDR9 A0A2K5NTW9 G7NDI0 G7PQC1
XP_005578148.1.63531 XP_011856757.1.47321 XP_011930541.1.92194 XP_014969885.1.72884 ENSPANP00000000651 ENSMMUP00000003303 ENSMMUP00000003303 9544.ENSMMUP00000003303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]