SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007855 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007855
Domain Number 1 Region: 17-89
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.43e-19
Family Frataxin-like 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007855   Gene: ENSMMUG00000005975   Transcript: ENSMMUT00000008360
Sequence length 102
Comment pep:known chromosome:MMUL_1:7:141235315:141236184:-1 gene:ENSMMUG00000005975 transcript:ENSMMUT00000008360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAALVILVTTGLSTFSLPLKSGVLTIKLGGDLGMYLINKQTPNKQIWLFSPSSGPKWYEW
TGKNCVYSHDRVSLQELLATEFTEVLKTKLDLSPWPIPEKTL
Download sequence
Identical sequences G7PB38
ENSMMUP00000007855 9544.ENSMMUP00000007855 ENSMMUP00000007855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]